Early Access: Sign up to unlock all Pro features free through the end of 2026.
Biblexika
Bible's InfluenceWe Three Kings of Orient Are
Music Major WorkChristmas Music

We Three Kings of Orient Are

John Henry Hopkins Jr.1857
Modern
United States

John Henry Hopkins Jr. wrote both words and music for this Epiphany carol, following Matthew 2:1-12 and drawing from Isaiah 60:6 ('Herds of camels will cover your land... All from Sheba will come, bearing gold and incense and proclaiming the praise of the LORD'). Each of the three king stanzas presents one gift - gold for his kingship (Psalm 72:15), frankincense for his deity (Exodus 30:34), myrrh for his death (Mark 15:23) - making it a theologically layered meditation on the Incarnation, priesthood, and passion. The haunting minor key of the verse creates one of the most recognizable Christmas carol melodies.

"We Three Kings of Orient Are" is the most theologically sophisticated of the standard English Christmas carols - a structured meditation on the three gifts of the Magi that uses each gift to reveal a different dimension of Christ's identity. Written by an American Episcopal clergyman, it remains the definitive Epiphany carol in the English language.

The Composition

John Henry Hopkins Jr. (1820-1891) wrote both words and music for this carol, an unusual achievement - most hymn texts and tunes are composed separately. He wrote it in 1857 for a Christmas pageant at the General Theological Seminary in New York City, where he was studying for ordination. The carol was published in his 1863 collection Carols, Hymns, and Songs. Hopkins was an Episcopal clergyman who served several parishes and was also a stained glass artist - his aesthetic sensibility is evident in the carol's formal structure and visual imagery.

Biblical Text

The primary biblical source is Matthew 2:1-12, the visit of the Magi to the infant Jesus. Matthew does not specify the number of visitors, identify them as kings, or name them - the tradition of three kings named Melchior, Caspar, and Balthasar developed gradually in patristic and medieval tradition, based on the three gifts. Hopkins follows the traditional reading while giving each gift a distinct theological commentary.

Isaiah 60:6 - 'All from Sheba will come, bearing gold and incense and proclaiming the praise of the LORD' - provides the Old Testament typology: the Queen of Sheba's tribute to Solomon (1 Kings 10:1-13) anticipates the Magi's tribute to the greater king. The gold of verse one draws on Psalm 72:15 ('Long may he live! May gold from Sheba be given him') - the royal psalm about the ideal king whose dominion extends to all nations. Frankincense evokes the priestly symbolism of Exodus 30:34 and Leviticus 2:1-2 - the incense of the holy place, the fragrance of divine worship. Myrrh draws on Mark 15:23 (the myrrh offered to Jesus at the crucifixion) and John 19:39 (Nicodemus bringing myrrh and aloes to anoint the body) - myrrh as the spice of death and burial.

Musical Analysis

Hopkins's tune is in 3/4 time in the minor mode - unusual for a carol, most of which are in major keys and 4/4 or 6/8 time. The minor key gives the carol a distinctive haunting quality that sets it apart from the more celebratory carols of the Christmas season. The verse melody is modal and archaic-sounding, with a modal inflection that evokes the ancient Middle East; the refrain ('O star of wonder, star of night') shifts to a richer harmonic language. The contrast between the modal verse and the broader refrain creates a musical structure that mirrors the theological movement: from the particular story of each gift to the universal adoration of the star.

Theological Structure

The carol's genius is its sequential theology: each of the three king stanzas presents one aspect of Christ's identity through one gift.

Gold is the gift for a king. The first king stanza presents Christ as the king whose throne surpasses all earthly thrones - drawing on the royal psalms (Psalm 2, 72, 110) and on the Christological title 'King of kings' (Revelation 19:16). The gold that tribute kings brought to Solomon is now brought to the king Solomon prefigured.

Frankincense is the gift for a god. The second king stanza presents Christ as the one to whom divine worship is offered - drawing on the priestly symbolism of the tabernacle and temple, where incense was the sign of prayer ascending to God (Psalm 141:2, Revelation 8:3-4). Only the divine being properly receives the incense of worship.

Myrrh is the gift for one who will die. The third king stanza is the most unusual and most powerful: it presents a gift appropriate to the crucifixion at the manger. The myrrh foreshadows Gethsemane, Golgotha, and the sealed tomb - a shadow of death falling across the nativity scene that gives the carol its theological weight. Hopkins refuses to sentimentalize the Incarnation: the child born to be king and God is also born to die, and the Magi's myrrh knows this from the beginning.

The refrain ('O star of wonder, star of night') unifies the three theologies under the image of the guiding star - the Shekinah glory of God made visible in a new creation sign, guiding Gentiles to the Jewish Messiah in fulfillment of the Gentile mission implicit throughout the Old Testament.

Cultural Legacy

The carol has become the standard Epiphany carol in most English-speaking traditions. It has been recorded in thousands of arrangements, from traditional choral settings to jazz and folk versions, and is one of the most recognized carol melodies worldwide. Its annual performance in Epiphany services continues to fulfill its original pedagogical purpose: teaching the theological significance of the gifts as a structured meditation on Christ's identity.

Bible References (3)

Listen & Watch

Tags

hopkinsepiphanymagimatthewisaiahgold-frankincense-myrrhcarol

Frequently Asked Questions

Related Works

Details
Domain
Music
Type
Christmas Music
Period
Modern
Region
United States
Year
1857
Significance
Major Work
Bible Refs
3
🎵
Music

Oratorios, hymns, requiems, and sacred compositions rooted in biblical texts and imagery.

Back to Bible's Influence